PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G01330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 313aa    MW: 34731.1 Da    PI: 6.1192
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G01330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14e-131474148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.............TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.............kgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++                 + R+ k+c++rw +yl
  LPERR11G01330.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPINTDesmaidelklhagLMRCSKSCRLRWTNYL 74
                     79****************************9999*************************97 PP

2Myb_DNA-binding45.12.3e-1480125148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  +v++  +lG++ W++Ia++++  Rt++++k++w+++l
  LPERR11G01330.1  80 RGNFTAHEEGMIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 125
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-23577IPR009057Homeodomain-like
PROSITE profilePS5129414.072974IPR017930Myb domain
SuperFamilySSF466891.43E-2711121IPR009057Homeodomain-like
SMARTSM007176.6E-101376IPR001005SANT/Myb domain
PfamPF002492.5E-121474IPR001005SANT/Myb domain
CDDcd001671.76E-91674No hitNo description
PROSITE profilePS5129422.375129IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2378129IPR009057Homeodomain-like
SMARTSM007175.9E-1379127IPR001005SANT/Myb domain
PfamPF002493.2E-1280125IPR001005SANT/Myb domain
CDDcd001671.74E-982125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRPPCCDKE GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PINTDESMAI DELKLHAGLM  60
RCSKSCRLRW TNYLRPGIKR GNFTAHEEGM IVHLQSLLGN RWAAIASYLP QRTDNDIKNY  120
WNTHLKKKLA VANSTNSISS GNNRHPIFAT GSSNNQPEIT QMAAIARRSP FADCPSSSYA  180
SSMDNISKLL DGFMKTTSPS PPPPPLQHYD VGYDDVKPAV ENPLMSFDCM SGTGGGEMDC  240
FDVYHHHQQQ PASSFMDQYG GYGGYGEESK KMMNHQAPPL SSIEKWLFDE AAAEQVADLM  300
DLSDGCCSVP MMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-23141294105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1235254e-98AC123525.2 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0056E15, complete sequence.
GenBankAP0149674e-98AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankCP0126194e-98CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
GenBankCP0126204e-98CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616542.11e-157PREDICTED: myb-related protein 306
SwissprotP813925e-79MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D9XNL50.0A0A0D9XNL5_9ORYZ; Uncharacterized protein
STRINGBGIOSGA034582-PA1e-156(Oryza sativa Indica Group)
STRINGLOC_Os11g03440.11e-156(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.15e-85myb domain protein 60